Sescmg.com.br

Sescmg.com.br is a domain within the top level domain com.br. According to Alexa sescmg.com.br has a global traffic rank of 248,720 based on pageviews and visits within the past month. The website actividadesdeinfantilyprimaria.com is ranked higher, and antenadigital.co ranks lower than sescmg.com.br.

IP Addresses and Server Locations

sescmg.com.br resolves to 186.248.91.147. According to our data this IP address belongs to Cemig Telecomunicações SA and is located in Santa Luzia, Minas Gerais, Brazil. Please have a look at the information provided below for further details.

186.248.91.147

ISPLevel 3 Communications
OrganizationCemig Telecomunicações SA
LocationSanta Luzia, Minas Gerais, Brazil (BR)
Latitude-19.7691 / 19°46′8″ S
Longitude-43.8540 / 43°51′14″ W
TimezoneBrazil/Acre
Local Time

DNS Resource Records

NameTypeDataTTL
sescmg.com.brA186.248.91.14786400
sescmg.com.brMX0 sescmg-com-br.mail.protection.outlook.com86400
sescmg.com.brNSa.sec.dns.br86399
sescmg.com.brNSb.sec.dns.br86399
sescmg.com.brSOAa.sec.dns.br. hostmaster.registro.br. 2017334001 345600 900 604800 90086399
Fetching Traffic Estimation for sescmg.com.br...

WHOIS data for Sescmg.com.br

Fetching WHOIS data for sescmg.com.br...

Website Information

Fetching Website Information for sescmg.com.br...

Reverse IP Lookup - Hostnames at the same IP address

Subdomains for Sescmg.com.br

Recommended Articles Based on Your Search

Tips

Back To Top